Lineage for d6bjka1 (6bjk A:64-345)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473281Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2473282Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2473713Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2473824Protein Glycosyltransferase B [75278] (1 species)
    involved in blood group antigen biosynthesis
  7. 2473825Species Human (Homo sapiens) [TaxId:9606] [75279] (17 PDB entries)
  8. 3057592Domain d6bjka1: 6bjk A:64-345 [357654]
    Other proteins in same PDB: d6bjka2
    automated match to d1lzja_
    complexed with gol; mutant

Details for d6bjka1

PDB Entry: 6bjk (more details), 2.12 Å

PDB Description: human abo(h) blood group glycosyltransferase gtb d302c mutant
PDB Compounds: (A:) ABO blood group (Transferase A, alpha 1-3-N-acetylgalactosaminyltransferase transferase B, alpha 1-3-galactosyltransferase)

SCOPe Domain Sequences for d6bjka1:

Sequence, based on SEQRES records: (download)

>d6bjka1 c.68.1.9 (A:64-345) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssrea
ftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhce
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d6bjka1 c.68.1.9 (A:64-345) Glycosyltransferase B {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevfcerrfls
evdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegd
fyymgaffggsvqevqrltrachqammvdqangieavwhceshlnkyllrhkptkvlspe
ylwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d6bjka1:

Click to download the PDB-style file with coordinates for d6bjka1.
(The format of our PDB-style files is described here.)

Timeline for d6bjka1:

  • d6bjka1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-20

View in 3D
Domains from same chain:
(mouse over for more information)
d6bjka2