Lineage for d6ae3b_ (6ae3 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543788Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 3057588Species Mus musculus [TaxId:10090] [357651] (1 PDB entry)
  8. 3057590Domain d6ae3b_: 6ae3 B: [357652]
    automated match to d1j1bb_
    complexed with gol, mri

Details for d6ae3b_

PDB Entry: 6ae3 (more details), 2.14 Å

PDB Description: crystal structure of gsk3beta complexed with morin
PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d6ae3b_:

Sequence, based on SEQRES records: (download)

>d6ae3b_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Mus musculus [TaxId: 10090]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

Sequence, based on observed residues (ATOM records): (download)

>d6ae3b_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Mus musculus [TaxId: 10090]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdfknre
lqimrkldhcnivrlryffyssekkdevylnlvldyvpetvyrvarhysrakqtlpviyv
klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
eqiremnpnyfkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsff
delrdpnvklpngrdtpalfnfttqelssnpplatilipphari

SCOPe Domain Coordinates for d6ae3b_:

Click to download the PDB-style file with coordinates for d6ae3b_.
(The format of our PDB-style files is described here.)

Timeline for d6ae3b_:

  • d6ae3b_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-20