Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d6g7fq1: 6g7f Q:1-234 [357644] Other proteins in same PDB: d6g7fa_, d6g7fc2, d6g7fe_, d6g7fg_, d6g7fi_, d6g7fj_, d6g7fk_, d6g7fl_, d6g7fn_, d6g7fo_, d6g7fq2, d6g7fs_, d6g7fu_, d6g7fw_, d6g7fx_, d6g7fy_, d6g7fz_ automated match to d1rypd_ complexed with cl, epw, mg |
PDB Entry: 6g7f (more details), 2.7 Å
SCOPe Domain Sequences for d6g7fq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g7fq1 d.153.1.4 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d6g7fq1:
View in 3D Domains from other chains: (mouse over for more information) d6g7fa_, d6g7fb_, d6g7fc1, d6g7fc2, d6g7fd_, d6g7fe_, d6g7ff_, d6g7fg_, d6g7fh_, d6g7fi_, d6g7fj_, d6g7fk_, d6g7fl_, d6g7fm_, d6g7fn_, d6g7fo_, d6g7fp_, d6g7fr_, d6g7fs_, d6g7ft_, d6g7fu_, d6g7fv_, d6g7fw_, d6g7fx_, d6g7fy_, d6g7fz_ |