Lineage for d6g7fc_ (6g7f C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600707Domain d6g7fc_: 6g7f C: [357641]
    Other proteins in same PDB: d6g7fa_, d6g7fe_, d6g7fg_, d6g7fi_, d6g7fj_, d6g7fk_, d6g7fl_, d6g7fn_, d6g7fo_, d6g7fs_, d6g7fu_, d6g7fw_, d6g7fx_, d6g7fy_, d6g7fz_
    automated match to d1rypd_
    complexed with cl, epw, mg

Details for d6g7fc_

PDB Entry: 6g7f (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with cystargolide b
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d6g7fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g7fc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d6g7fc_:

Click to download the PDB-style file with coordinates for d6g7fc_.
(The format of our PDB-style files is described here.)

Timeline for d6g7fc_:

  • d6g7fc_ is new in SCOPe 2.07-stable
  • d6g7fc_ appears in the current release, SCOPe 2.08, called d6g7fc1