SCOPe 2.08: Domain d5nayd1: 5nay D:2-114

Lineage for d5nayd1 (5nay D:2-114)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
   duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
   automatically mapped to Pfam PF01413

6. Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75587] (5 PDB entries)

8. Domain d5nayd1: 5nay D:2-114 [357624]
   automated match to d1li1a1
   complexed with cl, so4

Details for d5nayd1

PDB Entry: 5nay, 1.8 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha1nc1

PDB Compounds: (D:) Collagen alpha-1(IV) chain

SCOPe Domain Sequences for d5nayd1:

Sequence; same for both SEQRES and ATOM records:

>d5nayd1 d.169.1.6 (D:2-114) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]}
vdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmp
flfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap

Timeline for d5nayd1:

• d5nayd1 first appeared in SCOPe 2.07