Lineage for d6g8np_ (6g8n P:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552960Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (160 PDB entries)
  8. 3057559Domain d6g8np_: 6g8n P: [357621]
    Other proteins in same PDB: d6g8na_, d6g8ne_, d6g8ng_, d6g8ni_, d6g8nj_, d6g8nk_, d6g8nl_, d6g8nn_, d6g8no_, d6g8ns_, d6g8nu_, d6g8nw_, d6g8nx_, d6g8ny_, d6g8nz_
    automated match to d4cr2c_
    complexed with cl, eqb, mg

Details for d6g8np_

PDB Entry: 6g8n (more details), 3 Å

PDB Description: yeast 20s proteasome in complex with cystargolide b derivative 2
PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6g8np_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g8np_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d6g8np_:

Click to download the PDB-style file with coordinates for d6g8np_.
(The format of our PDB-style files is described here.)

Timeline for d6g8np_:

  • d6g8np_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13