Lineage for d5nayb1 (5nay B:2-114)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559542Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 2559543Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 2559629Species Human (Homo sapiens) [TaxId:9606] [75587] (4 PDB entries)
  8. 3057548Domain d5nayb1: 5nay B:2-114 [357610]
    automated match to d1li1a1
    complexed with cl, so4

Details for d5nayb1

PDB Entry: 5nay (more details), 1.8 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha1nc1
PDB Compounds: (B:) Collagen alpha-1(IV) chain

SCOPe Domain Sequences for d5nayb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nayb1 d.169.1.6 (B:2-114) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]}
vdhgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmp
flfcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap

SCOPe Domain Coordinates for d5nayb1:

Click to download the PDB-style file with coordinates for d5nayb1.
(The format of our PDB-style files is described here.)

Timeline for d5nayb1:

  • d5nayb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13