Lineage for d5zfgb2 (5zfg B:87-209)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2323134Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)
  8. 3057547Domain d5zfgb2: 5zfg B:87-209 [357609]
    Other proteins in same PDB: d5zfga1, d5zfgb1
    automated match to d3wywa2
    complexed with act, edo

Details for d5zfgb2

PDB Entry: 5zfg (more details), 1.7 Å

PDB Description: crystal structure of a diazinon-metabolizing glutathione s-transferase in the silkworm, bombyx mori
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d5zfgb2:

Sequence, based on SEQRES records: (download)

>d5zfgb2 a.45.1.0 (B:87-209) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
qdpksraivnhrlcfnlssyyanisaytmapiffdyertplglkkvhisldvletyltrt
ntsyaaanhltiadfplinstmtleaidfdfskytkihkwyndfkvkypdlwkisesamk
eiq

Sequence, based on observed residues (ATOM records): (download)

>d5zfgb2 a.45.1.0 (B:87-209) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
qdpksraivnhrlcfnlssyyanisaytmaertplglkkvhisldvletyltrtntsyaa
anhltiadfplinstmtleaidfdfskytkihkwyndfkvkypdlwkisesamkeiq

SCOPe Domain Coordinates for d5zfgb2:

Click to download the PDB-style file with coordinates for d5zfgb2.
(The format of our PDB-style files is described here.)

Timeline for d5zfgb2:

  • d5zfgb2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5zfgb1