Lineage for d5zfgb1 (5zfg B:1-86)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (173 species)
    not a true protein
  7. 2458682Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (9 PDB entries)
  8. 3057546Domain d5zfgb1: 5zfg B:1-86 [357608]
    Other proteins in same PDB: d5zfga2, d5zfgb2
    automated match to d3wywa1
    complexed with act, edo

Details for d5zfgb1

PDB Entry: 5zfg (more details), 1.7 Å

PDB Description: crystal structure of a diazinon-metabolizing glutathione s-transferase in the silkworm, bombyx mori
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d5zfgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zfgb1 c.47.1.0 (B:1-86) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
mvlklyavsdgppslsvrqalvalevpfelinvdfgagehmtsdyalmnpqkeipvldde
gfylsesnailqyicdkyrpgsplyp

SCOPe Domain Coordinates for d5zfgb1:

Click to download the PDB-style file with coordinates for d5zfgb1.
(The format of our PDB-style files is described here.)

Timeline for d5zfgb1:

  • d5zfgb1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5zfgb2