Lineage for d5zrra1 (5zrr A:45-304)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2475442Family c.69.1.16: Lipase [53555] (2 proteins)
  6. 2475447Protein automated matches [254730] (4 species)
    not a true protein
  7. 2475448Species Saccharomonospora viridis [TaxId:1852] [269028] (7 PDB entries)
  8. 3057542Domain d5zrra1: 5zrr A:45-304 [357604]
    Other proteins in same PDB: d5zrra2, d5zrra3
    automated match to d4wfia_
    complexed with 9j3, gol, so4, zn; mutant

Details for d5zrra1

PDB Entry: 5zrr (more details), 1.34 Å

PDB Description: crystal structure of pet-degrading cutinase cut190 s176a/s226p/r228s mutant in monoethyl succinate bound state
PDB Compounds: (A:) Alpha/beta hydrolase family protein

SCOPe Domain Sequences for d5zrra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zrra1 c.69.1.16 (A:45-304) automated matches {Saccharomonospora viridis [TaxId: 1852]}
qdnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavavap
gftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvrer
ldpnrlavmghamggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeldti
apvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtrysq
flcpnptdraieeyrstcpy

SCOPe Domain Coordinates for d5zrra1:

Click to download the PDB-style file with coordinates for d5zrra1.
(The format of our PDB-style files is described here.)

Timeline for d5zrra1:

  • d5zrra1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13