Lineage for d5ycda_ (5ycd A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2446889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2447423Protein automated matches [190087] (14 species)
    not a true protein
  7. 3057516Species Poecilia reticulata [TaxId:8081] [357578] (1 PDB entry)
  8. 3057530Domain d5ycda_: 5ycd A: [357592]
    automated match to d3adka_
    complexed with ap5, mg

Details for d5ycda_

PDB Entry: 5ycd (more details), 1.8 Å

PDB Description: crystal structure of poecilia reticulata adenylate kinase
PDB Compounds: (A:) Adenylayte kinase

SCOPe Domain Sequences for d5ycda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ycda_ c.37.1.1 (A:) automated matches {Poecilia reticulata [TaxId: 8081]}
dkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqaimq
kgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvdaka
etmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavddv
fgqvskaidal

SCOPe Domain Coordinates for d5ycda_:

Click to download the PDB-style file with coordinates for d5ycda_.
(The format of our PDB-style files is described here.)

Timeline for d5ycda_:

  • d5ycda_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13