Lineage for d6h8tj_ (6h8t J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497141Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2497433Protein Papain [54005] (1 species)
  7. 2497434Species Papaya (Carica papaya) [TaxId:3649] [54006] (24 PDB entries)
  8. 3057514Domain d6h8tj_: 6h8t J: [357576]
    automated match to d1ppna_
    complexed with act, cl, na, so4, yxx, yxz

Details for d6h8tj_

PDB Entry: 6h8t (more details), 2.1 Å

PDB Description: crystal structure of papain modify by achiral ru(ii)complex
PDB Compounds: (J:) papain

SCOPe Domain Sequences for d6h8tj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h8tj_ d.3.1.1 (J:) Papain {Papaya (Carica papaya) [TaxId: 3649]}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

SCOPe Domain Coordinates for d6h8tj_:

Click to download the PDB-style file with coordinates for d6h8tj_.
(The format of our PDB-style files is described here.)

Timeline for d6h8tj_:

  • d6h8tj_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13