Lineage for d5ycbb_ (5ycb B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2446889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2447423Protein automated matches [190087] (14 species)
    not a true protein
  7. 3053501Species Notothenia coriiceps [TaxId:8208] [353563] (3 PDB entries)
  8. 3057510Domain d5ycbb_: 5ycb B: [357572]
    automated match to d3adka_
    complexed with ap5, so4

Details for d5ycbb_

PDB Entry: 5ycb (more details), 2.27 Å

PDB Description: crystal structure of notothenia coriiceps adenylate kinase variant
PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d5ycbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ycbb_ c.37.1.1 (B:) automated matches {Notothenia coriiceps [TaxId: 8208]}
akiifvvggpgsgkgtqcekvvakygythlssgdllraevssgsergkqlqaimqkgelv
pldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyidakgetmvk
rlmkrgetsgraddneetikkrldlyykatepviafyegrgivrkidselpvdevfkqvs
taidal

SCOPe Domain Coordinates for d5ycbb_:

Click to download the PDB-style file with coordinates for d5ycbb_.
(The format of our PDB-style files is described here.)

Timeline for d5ycbb_:

  • d5ycbb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13