Lineage for d5ycfb_ (5ycf B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2446889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2447423Protein automated matches [190087] (14 species)
    not a true protein
  7. 3057508Species Xiphophorus maculatus [TaxId:8083] [357570] (1 PDB entry)
  8. 3057509Domain d5ycfb_: 5ycf B: [357571]
    automated match to d3adka_
    complexed with ap5

Details for d5ycfb_

PDB Entry: 5ycf (more details), 1.94 Å

PDB Description: crystal structure of xiphophorus maculatus adenylate kinase
PDB Compounds: (B:) adenylate kinase isoenzyme 1

SCOPe Domain Sequences for d5ycfb_:

Sequence, based on SEQRES records: (download)

>d5ycfb_ c.37.1.1 (B:) automated matches {Xiphophorus maculatus [TaxId: 8083]}
madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
kaetmvkrllkrgetsgrsddneetikkrldlyykatepviafyegrgivkkvdselavd
dvfaqvskaidal

Sequence, based on observed residues (ATOM records): (download)

>d5ycfb_ c.37.1.1 (B:) automated matches {Xiphophorus maculatus [TaxId: 8083]}
madkikdakiifvvggpgsgkgtqcekivakygythlssgdllraevasgsergkqlqai
mqkgelvpldtvldmikdamiakadvskgflidgyprevkqgeefekkigkpclllyvda
kaetmvkrllkrrsddneetikkrldlyykatepviafyegrgivkkvdselavddvfaq
vskaidal

SCOPe Domain Coordinates for d5ycfb_:

Click to download the PDB-style file with coordinates for d5ycfb_.
(The format of our PDB-style files is described here.)

Timeline for d5ycfb_:

  • d5ycfb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13