Lineage for d5naza2 (5naz A:115-229)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559542Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 3057505Protein automated matches [357567] (1 species)
    not a true protein
  7. 3057506Species Homo sapiens [TaxId:9606] [357568] (1 PDB entry)
  8. 3057507Domain d5naza2: 5naz A:115-229 [357569]
    Other proteins in same PDB: d5naza1
    automated match to d1li1a2
    complexed with cl, pg4

Details for d5naza2

PDB Entry: 5naz (more details), 1.85 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha5nc1
PDB Compounds: (A:) Collagen alpha-5(IV) chain

SCOPe Domain Sequences for d5naza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5naza2 d.169.1.6 (A:115-229) automated matches {Homo sapiens [TaxId: 9606]}
avviavhsqtiqiphcpqgwdslwigysfmmhtsagaegsgqalaspgscleefrsapfi
echgrgtcnyyansysfwlatvdvsdmfskpqsetlkagdlrtrisrcqvcmkrt

SCOPe Domain Coordinates for d5naza2:

Click to download the PDB-style file with coordinates for d5naza2.
(The format of our PDB-style files is described here.)

Timeline for d5naza2:

  • d5naza2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5naza1