Lineage for d5naza1 (5naz A:4-114)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (16 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (83 PDB entries)
  8. 3057504Domain d5naza1: 5naz A:4-114 [357566]
    Other proteins in same PDB: d5naza2
    automated match to d1li1a1
    complexed with cl, pg4

Details for d5naza1

PDB Entry: 5naz (more details), 1.85 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha5nc1
PDB Compounds: (A:) Collagen alpha-5(IV) chain

SCOPe Domain Sequences for d5naza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5naza1 d.169.1.0 (A:4-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgflitrhsqttdapqcpqgtlqvyegfsllyvqgnkrahgqdlgtagsclrrfstmpfm
fcninnvcnfasrndysywlstpepmpmsmqplkgqsiqpfisrcavceap

SCOPe Domain Coordinates for d5naza1:

Click to download the PDB-style file with coordinates for d5naza1.
(The format of our PDB-style files is described here.)

Timeline for d5naza1:

  • d5naza1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5naza2