Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [53857] (5 PDB entries) |
Domain d1lafe_: 1laf E: [35756] |
PDB Entry: 1laf (more details), 2.06 Å
SCOP Domain Sequences for d1lafe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lafe_ c.94.1.1 (E:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} alpqtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslk akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd
Timeline for d1lafe_: