Lineage for d5o03d1 (5o03 D:6-135)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (155 PDB entries)
  8. 3057495Domain d5o03d1: 5o03 D:6-135 [357557]
    Other proteins in same PDB: d5o03c2, d5o03d2
    automated match to d5hggs_
    complexed with edo, imd

Details for d5o03d1

PDB Entry: 5o03 (more details), 2.19 Å

PDB Description: gii.10 vietnam 026 protruding domain in complex with nanobody nano-32
PDB Compounds: (D:) Nanobody (VHH) Nano-32

SCOPe Domain Sequences for d5o03d1:

Sequence, based on SEQRES records: (download)

>d5o03d1 b.1.1.1 (D:6-135) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsanyaasvk
grftisrdnakntvylqmnslkpedtaiyycaadlsslttvqamcviprpgfsakaydyw
glgtqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d5o03d1 b.1.1.1 (D:6-135) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgftlgyypigwfrqapgkglegvscisgsggsanyaasvk
grftisrdnakntvylqmnslkpedtaiyycaadlsslvqamcviprpgfsakaydywgl
gtqvtvss

SCOPe Domain Coordinates for d5o03d1:

Click to download the PDB-style file with coordinates for d5o03d1.
(The format of our PDB-style files is described here.)

Timeline for d5o03d1:

  • d5o03d1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d5o03d2