Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
Domain d5nb1f1: 5nb1 F:5-112 [357553] automated match to d1li1c1 |
PDB Entry: 5nb1 (more details), 2.82 Å
SCOPe Domain Sequences for d5nb1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nb1f1 d.169.1.0 (F:5-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} gfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfay cnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceap
Timeline for d5nb1f1: