Lineage for d5ni3a_ (5ni3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2508387Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2508388Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2508389Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2508715Protein automated matches [190406] (18 species)
    not a true protein
  7. 2508906Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (39 PDB entries)
  8. 3057487Domain d5ni3a_: 5ni3 A: [357549]
    Other proteins in same PDB: d5ni3b_, d5ni3c_, d5ni3d_
    automated match to d2b3pa_
    complexed with cl, db5, gol, na; mutant

Details for d5ni3a_

PDB Entry: 5ni3 (more details), 1.28 Å

PDB Description: sfgfp 204-204 mutant dimer
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5ni3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ni3a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvnr
ielkgidfkedgnilghkleynfnshnvyitadkqkngikanfkirhnvedgsvqladhy
qqntpigdgpvllpdnhylstfsvlskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d5ni3a_:

Click to download the PDB-style file with coordinates for d5ni3a_.
(The format of our PDB-style files is described here.)

Timeline for d5ni3a_:

  • d5ni3a_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13