Lineage for d5ojea_ (5oje A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2393116Protein Endothiapepsin [50647] (1 species)
  7. 2393117Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (510 PDB entries)
  8. 3057483Domain d5ojea_: 5oje A: [357545]
    automated match to d1oewa_
    complexed with dms, gol, pge, so4, vsk

Details for d5ojea_

PDB Entry: 5oje (more details), 1.58 Å

PDB Description: endothiapepsin with ligand vsk-b24
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5ojea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ojea_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d5ojea_:

Click to download the PDB-style file with coordinates for d5ojea_.
(The format of our PDB-style files is described here.)

Timeline for d5ojea_:

  • d5ojea_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13