Lineage for d5naxe2 (5nax E:113-226)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559542Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 2559543Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 2559629Species Human (Homo sapiens) [TaxId:9606] [75587] (4 PDB entries)
  8. 3057478Domain d5naxe2: 5nax E:113-226 [357540]
    automated match to d1li1f2
    complexed with cl

Details for d5naxe2

PDB Entry: 5nax (more details), 2.82 Å

PDB Description: crystal structures of homooligomers of the non-collagenous domains of collagen type iv. alpha121nc1
PDB Compounds: (E:) Collagen alpha-2(IV) chain

SCOPe Domain Sequences for d5naxe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5naxe2 d.169.1.6 (E:113-226) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]}
aiaiavhsqdvsiphcpagwrslwigysflmhtaagdegggqslvspgscledfratpfi
ecnggrgtchyyankysfwlttipeqsfqgspsadtlkaglirthisrcqvcmk

SCOPe Domain Coordinates for d5naxe2:

Click to download the PDB-style file with coordinates for d5naxe2.
(The format of our PDB-style files is described here.)

Timeline for d5naxe2:

  • d5naxe2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13