Lineage for d5nb1a1 (5nb1 A:4-112)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (16 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (83 PDB entries)
  8. 3057471Domain d5nb1a1: 5nb1 A:4-112 [357533]
    automated match to d1li1c1

Details for d5nb1a1

PDB Entry: 5nb1 (more details), 2.82 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha4nc1
PDB Compounds: (A:) Collagen alpha-4(IV) chain

SCOPe Domain Sequences for d5nb1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nb1a1 d.169.1.0 (A:4-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggfllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfa
ycnihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceap

SCOPe Domain Coordinates for d5nb1a1:

Click to download the PDB-style file with coordinates for d5nb1a1.
(The format of our PDB-style files is described here.)

Timeline for d5nb1a1:

  • d5nb1a1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13