Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain [53854] (1 species) |
Species Escherichia coli [TaxId:562] [53855] (5 PDB entries) |
Domain d2ypna1: 2ypn A:3-219 [35753] Other proteins in same PDB: d2ypna2 complexed with dpm |
PDB Entry: 2ypn (more details), 2.3 Å
SCOPe Domain Sequences for d2ypna1:
Sequence, based on SEQRES records: (download)
>d2ypna1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]} dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvtrgdvildtplakvggkglf vkelevallenradiavhsmkdvpvefpqglglvticeredprdafvsnnydsldalpag sivgtsslrrqcqlaerrpdliirslrgnvgtrlskldngeydaiilavaglkrlglesr iraalppeislpavgqgavgiecrlddsrtrellaal
>d2ypna1 c.94.1.1 (A:3-219) Porphobilinogen deaminase (hydroxymethylbilane synthase), N-terminal domain {Escherichia coli [TaxId: 562]} dnvlriatrqsplalwqahyvkdklmashpglvvelvpmvglfvkelevallenradiav hsmkdvpvefpqglglvticeredprdafvsnnydsldalpagsivgtsslrrqcqlaer rpdliirslrgnvgtrlskldngeydaiilavaglkrlglesriraalppeislpavgqg avgiecrlddsrtrellaal
Timeline for d2ypna1: