Lineage for d6g8mg_ (6g8m G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (15 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (94 PDB entries)
  8. 3057459Domain d6g8mg_: 6g8m G: [357521]
    Other proteins in same PDB: d6g8ma_, d6g8mb_, d6g8mc_, d6g8md_, d6g8me_, d6g8mf_, d6g8mh_, d6g8mi_, d6g8mj_, d6g8mk_, d6g8ml_, d6g8mm_, d6g8mn_, d6g8mo_, d6g8mp_, d6g8mq_, d6g8mr_, d6g8ms_, d6g8mt_, d6g8mv_, d6g8mw_, d6g8mx_, d6g8my_, d6g8mz_
    automated match to d1irua_
    complexed with cl, eqe, mg

Details for d6g8mg_

PDB Entry: 6g8m (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with cystargolide b derivative 1
PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d6g8mg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g8mg_ d.153.1.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d6g8mg_:

Click to download the PDB-style file with coordinates for d6g8mg_.
(The format of our PDB-style files is described here.)

Timeline for d6g8mg_:

  • d6g8mg_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13