Lineage for d6ayla1 (6ayl A:0-131)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396280Protein automated matches [190295] (6 species)
    not a true protein
  7. 2396296Species Human (Homo sapiens) [TaxId:9606] [187133] (56 PDB entries)
  8. 3057445Domain d6ayla1: 6ayl A:0-131 [357507]
    Other proteins in same PDB: d6ayla2
    automated match to d1vyfa_
    complexed with flu

Details for d6ayla1

PDB Entry: 6ayl (more details), 1.86 Å

PDB Description: human adipocyte lipid-binding protein fabp4 in complex with fluorescein
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d6ayla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ayla1 b.60.1.2 (A:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvm
kgvtstrvyera

SCOPe Domain Coordinates for d6ayla1:

Click to download the PDB-style file with coordinates for d6ayla1.
(The format of our PDB-style files is described here.)

Timeline for d6ayla1:

  • d6ayla1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6ayla2