Lineage for d6evla_ (6evl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2333769Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
  6. 2333906Protein automated matches [190103] (4 species)
    not a true protein
  7. 2333911Species Human (Homo sapiens) [TaxId:9606] [186825] (12 PDB entries)
  8. 3057393Domain d6evla_: 6evl A: [357455]
    automated match to d2v5fa_
    complexed with dms, gly, so4

Details for d6evla_

PDB Entry: 6evl (more details), 1.87 Å

PDB Description: crystal structure of an unlignaded peptide-substrate-binding domain of human type ii collagen prolyl 4-hydroxylase
PDB Compounds: (A:) Prolyl 4-hydroxylase subunit alpha-2

SCOPe Domain Sequences for d6evla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6evla_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlsvddcfgmgrsaynegdyyhtvlwmeqvlkqldageeatttksqvldylsyavfqlgd
lhraleltrrllsldpsheraggnlryfeqllee

SCOPe Domain Coordinates for d6evla_:

Click to download the PDB-style file with coordinates for d6evla_.
(The format of our PDB-style files is described here.)

Timeline for d6evla_:

  • d6evla_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13