Lineage for d6awgd_ (6awg D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2462099Family c.55.1.14: Fumble-like [159623] (4 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2462142Protein automated matches [259360] (2 species)
    not a true protein
  7. 3057179Species Staphylococcus aureus [TaxId:1280] [357241] (5 PDB entries)
  8. 3057388Domain d6awgd_: 6awg D: [357450]
    automated match to d4nb4a_
    complexed with adp, atp, c0g

Details for d6awgd_

PDB Entry: 6awg (more details), 2.4 Å

PDB Description: staphylococcus aureus type ii pantothenate kinase in complex with nucleotides and pantothenate analog deoxy-n190pan
PDB Compounds: (D:) Type II pantothenate kinase

SCOPe Domain Sequences for d6awgd_:

Sequence, based on SEQRES records: (download)

>d6awgd_ c.55.1.14 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkvgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaen
inipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtg
ggmiqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvl
hhldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedy
tvlrgckpyyvengafsgaigalyle

Sequence, based on observed residues (ATOM records): (download)

>d6awgd_ c.55.1.14 (D:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkvgidaggtlikivqenqrtfkteltknidqvvewlnqqqieklcltggnagviaenin
ipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtggg
miqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhh
ldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytv
lrgckpyyvengafsgaigalyle

SCOPe Domain Coordinates for d6awgd_:

Click to download the PDB-style file with coordinates for d6awgd_.
(The format of our PDB-style files is described here.)

Timeline for d6awgd_:

  • d6awgd_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13