Lineage for d6g7pa1 (6g7p A:4-319)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 3057297Species Trichodesmium erythraeum [TaxId:203124] [357359] (3 PDB entries)
  8. 3057381Domain d6g7pa1: 6g7p A:4-319 [357443]
    Other proteins in same PDB: d6g7pa2, d6g7pb2
    automated match to d2pt1a_
    complexed with cl, fe

Details for d6g7pa1

PDB Entry: 6g7p (more details), 1.5 Å

PDB Description: trichodesmium tery_3377 (idia) (futa) with iron and water ligands.
PDB Compounds: (A:) Extracellular solute-binding protein, family 1

SCOPe Domain Sequences for d6g7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g7pa1 c.94.1.0 (A:4-319) automated matches {Trichodesmium erythraeum [TaxId: 203124]}
gainlyssrhydtdqalydsftkktglkvnliegkgdklierikseganspadvfmtvda
grlwraqeagilqpissstlnnkipanlrspeklwfgfskrarvimynknkvqpselsty
edlaqnkwkgkivirsssniynqsliaslieihgmsdaegwakgfvrnfarppegndtaq
ikavaagigdiglansyylarlkrsskpedqavadkvgmffpnqngrgthvnisgggvvk
napnkegaikfleylvspeaqkifsegnneypvvagvpiasvlkpfgsfkndstnvsvyg
klnadaiklmdrvgwk

SCOPe Domain Coordinates for d6g7pa1:

Click to download the PDB-style file with coordinates for d6g7pa1.
(The format of our PDB-style files is described here.)

Timeline for d6g7pa1:

  • d6g7pa1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6g7pa2