Lineage for d6aw9c_ (6aw9 C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2468840Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2469011Protein automated matches [190251] (6 species)
    not a true protein
  7. 3057234Species Nannospalax galili [TaxId:1026970] [357296] (6 PDB entries)
  8. 3057369Domain d6aw9c_: 6aw9 C: [357431]
    automated match to d4p7ka_
    complexed with ca, sah

Details for d6aw9c_

PDB Entry: 6aw9 (more details), 2.55 Å

PDB Description: 2.55a resolution structure of sah bound catechol o-methyltransferase (comt) l136m from nannospalax galili
PDB Compounds: (C:) Catechol O-methyltransferase

SCOPe Domain Sequences for d6aw9c_:

Sequence, based on SEQRES records: (download)

>d6aw9c_ c.66.1.1 (C:) automated matches {Nannospalax galili [TaxId: 1026970]}
tkeqrilryvqqhakpgdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslvl
elgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdli
pqlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayvr
gsssfecthyssyleymkvvdglekavykgp

Sequence, based on observed residues (ATOM records): (download)

>d6aw9c_ c.66.1.1 (C:) automated matches {Nannospalax galili [TaxId: 1026970]}
tkeqrilryvqqhakpdpqsvleaidtyctqkewamnvgdakgqimdeviqehnpslvle
lgaycgysavrmarllspgarlltmeknpdyaaitqqmlnfaglqdkvtiligasqdlip
qlkkydvdtldmvfldhwkdrylpdtilleecgllrkgtvlladnvivpgtpdflayvrg
sssfecthyssyleymkvvdglekavykgp

SCOPe Domain Coordinates for d6aw9c_:

Click to download the PDB-style file with coordinates for d6aw9c_.
(The format of our PDB-style files is described here.)

Timeline for d6aw9c_:

  • d6aw9c_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13