Lineage for d6dvsa_ (6dvs A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (128 species)
    not a true protein
  7. 2473005Species Pseudomonas stutzeri [TaxId:316] [267772] (2 PDB entries)
  8. 3057367Domain d6dvsa_: 6dvs A: [357429]
    automated match to d2cy8a_
    complexed with act, edo, po4, so4, trs

Details for d6dvsa_

PDB Entry: 6dvs (more details), 1.82 Å

PDB Description: crystal structure of pseudomonas stutzeri d-phenylglycine aminotransferase
PDB Compounds: (A:) D-phenylglycine aminotransferase

SCOPe Domain Sequences for d6dvsa_:

Sequence, based on SEQRES records: (download)

>d6dvsa_ c.67.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
silndykrktegsvfwaqrarsvmpdgvtadtrvfdphglfisdaqgvhktdvdgnvyld
ffgghgalvlghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftgs
gtettllalrvaraftgrrmilriathyhgwhdfsasgynshfdgqpapgvlpeiakntl
lirpddiegmrevfaqhgsdiaafiaepvgshfgvtpvsdsflregaelarqygalfild
evisgfrvgnhgmqalldvqpdltclakasagglpggilggredvmgvlsrgsdrkvlhq
gtftgnpitaaaaiaaidtileddvcakindlgqfareamnhlfarkglnwlaygrfsgf
hlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdiggrgsvflsaqherehv
ehlvttfdrvldrladenllswqp

Sequence, based on observed residues (ATOM records): (download)

>d6dvsa_ c.67.1.0 (A:) automated matches {Pseudomonas stutzeri [TaxId: 316]}
silndykrktegsvfwaqrarsvmpddphglfisdaqgvhktdvdgnvyldffgghgalv
lghghprvnaaiaealshgvqyaashplevrwaerivaafpsirklrftgsgtettllal
rvaraftgrrmilriathyakntllirpddiegmrevfaqhgsdiaafiaepvgshfgvt
pvsdsflregaelarqygalfildevisgfrvgnhgmqalldvqpdltclakasagglpg
gilggredvmgvlstftgnpitaaaaiaaidtileddvcakindlgqfareamnhlfark
glnwlaygrfsgfhlmpglppnttdtgsitraevarpdvkmiaamrmalilegvdiggrg
svflsaqherehvehlvttfdrvldrladenllswqp

SCOPe Domain Coordinates for d6dvsa_:

Click to download the PDB-style file with coordinates for d6dvsa_.
(The format of our PDB-style files is described here.)

Timeline for d6dvsa_:

  • d6dvsa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13