SCOPe 2.08: Domain d6g7qa1: 6g7q A:4-319

Lineage for d6g7qa1 (6g7q A:4-319)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Trichodesmium erythraeum [TaxId:203124] [357359] (3 PDB entries)

8. Domain d6g7qa1: 6g7q A:4-319 [357417]
   Other proteins in same PDB: d6g7qa2
   automated match to d2pt1a_
   complexed with cl, fe, flc, gol

Details for d6g7qa1

PDB Entry: 6g7q, 1.2 Å

PDB Description: trichodesmium tery_3377 (idia) (futa) in complex with iron and citrate ligands.

PDB Compounds: (A:) Extracellular solute-binding protein, family 1

SCOPe Domain Sequences for d6g7qa1:

Sequence; same for both SEQRES and ATOM records:

>d6g7qa1 c.94.1.0 (A:4-319) automated matches {Trichodesmium erythraeum [TaxId: 203124]}
gainlyssrhydtdqalydsftkktglkvnliegkgdklierikseganspadvfmtvda
grlwraqeagilqpissstlnnkipanlrspeklwfgfskrarvimynknkvqpselsty
edlaqnkwkgkivirsssniynqsliaslieihgmsdaegwakgfvrnfarppegndtaq
ikavaagigdiglansyylarlkrsskpedqavadkvgmffpnqngrgthvnisgggvvk
napnkegaikfleylvspeaqkifsegnneypvvagvpiasvlkpfgsfkndstnvsvyg
klnadaiklmdrvgwk

Timeline for d6g7qa1:

• d6g7qa1 first appeared in SCOPe 2.07