Lineage for d6g7fu_ (6g7f U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2554828Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2554829Protein automated matches [190509] (15 species)
    not a true protein
  7. 2554883Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (94 PDB entries)
  8. 3057351Domain d6g7fu_: 6g7f U: [357413]
    Other proteins in same PDB: d6g7fa_, d6g7fb_, d6g7fc_, d6g7fd_, d6g7fe_, d6g7ff_, d6g7fh_, d6g7fi_, d6g7fj_, d6g7fk_, d6g7fl_, d6g7fm_, d6g7fn_, d6g7fo_, d6g7fp_, d6g7fq_, d6g7fr_, d6g7fs_, d6g7ft_, d6g7fv_, d6g7fw_, d6g7fx_, d6g7fy_, d6g7fz_
    automated match to d1irua_
    complexed with cl, epw, mg

Details for d6g7fu_

PDB Entry: 6g7f (more details), 2.7 Å

PDB Description: yeast 20s proteasome in complex with cystargolide b
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d6g7fu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g7fu_ d.153.1.0 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d6g7fu_:

Click to download the PDB-style file with coordinates for d6g7fu_.
(The format of our PDB-style files is described here.)

Timeline for d6g7fu_:

  • d6g7fu_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13