Lineage for d6fhpc_ (6fhp C:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2597483Fold j.78: C-terminal fragment of thermolysin [63387] (1 superfamily)
  4. 2597484Superfamily j.78.1: C-terminal fragment of thermolysin [63388] (1 family) (S)
  5. 2597485Family j.78.1.1: C-terminal fragment of thermolysin [63389] (1 protein)
  6. 2597486Protein C-terminal fragment of thermolysin [63390] (2 species)
  7. 3057289Species Geobacillus stearothermophilus [TaxId:1422] [357351] (1 PDB entry)
  8. 3057318Domain d6fhpc_: 6fhp C: [357380]
    automated match to d1trla_

Details for d6fhpc_

PDB Entry: 6fhp (more details), 1.7 Å

PDB Description: daip in complex with a c-terminal fragment of thermolysin
PDB Compounds: (C:) thermolysin

SCOPe Domain Sequences for d6fhpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fhpc_ j.78.1.1 (C:) C-terminal fragment of thermolysin {Geobacillus stearothermophilus [TaxId: 1422]}
gigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavgv

SCOPe Domain Coordinates for d6fhpc_:

Click to download the PDB-style file with coordinates for d6fhpc_.
(The format of our PDB-style files is described here.)

Timeline for d6fhpc_:

  • d6fhpc_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from other chains:
(mouse over for more information)
d6fhpd_