Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.0: automated matches [196988] (1 protein) not a true family |
Protein automated matches [196989] (16 species) not a true protein |
Species Escherichia coli [TaxId:83333] [357325] (1 PDB entry) |
Domain d6e4bd1: 6e4b D:1-200 [357366] Other proteins in same PDB: d6e4ba2, d6e4bb2, d6e4bc2, d6e4bd2 automated match to d4ij6b_ complexed with 1pe, cl, gol |
PDB Entry: 6e4b (more details), 2.55 Å
SCOPe Domain Sequences for d6e4bd1:
Sequence, based on SEQRES records: (download)
>d6e4bd1 c.60.1.0 (D:1-200) automated matches {Escherichia coli [TaxId: 83333]} mrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraqh tarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptngeg fqafsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcwsa idinqkfatlrvlnsraigv
>d6e4bd1 c.60.1.0 (D:1-200) automated matches {Escherichia coli [TaxId: 83333]} mrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraqh tarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqptngegfqa fsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcwsaidi nqkfatlrvlnsraigv
Timeline for d6e4bd1: