Lineage for d6e4bd1 (6e4b D:1-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2891217Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2891218Protein automated matches [196989] (16 species)
    not a true protein
  7. 2891231Species Escherichia coli [TaxId:83333] [357325] (1 PDB entry)
  8. 2891235Domain d6e4bd1: 6e4b D:1-200 [357366]
    Other proteins in same PDB: d6e4ba2, d6e4bb2, d6e4bc2, d6e4bd2
    automated match to d4ij6b_
    complexed with 1pe, cl, gol

Details for d6e4bd1

PDB Entry: 6e4b (more details), 2.55 Å

PDB Description: the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655
PDB Compounds: (D:) Adenosylcobalamin/alpha-ribazole phosphatase

SCOPe Domain Sequences for d6e4bd1:

Sequence, based on SEQRES records: (download)

>d6e4bd1 c.60.1.0 (D:1-200) automated matches {Escherichia coli [TaxId: 83333]}
mrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraqh
tarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptngeg
fqafsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcwsa
idinqkfatlrvlnsraigv

Sequence, based on observed residues (ATOM records): (download)

>d6e4bd1 c.60.1.0 (D:1-200) automated matches {Escherichia coli [TaxId: 83333]}
mrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraqh
tarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqptngegfqa
fsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcwsaidi
nqkfatlrvlnsraigv

SCOPe Domain Coordinates for d6e4bd1:

Click to download the PDB-style file with coordinates for d6e4bd1.
(The format of our PDB-style files is described here.)

Timeline for d6e4bd1: