Lineage for d6e4ba1 (6e4b A:1-202)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467369Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2467370Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2467600Family c.60.1.0: automated matches [196988] (1 protein)
    not a true family
  6. 2467601Protein automated matches [196989] (11 species)
    not a true protein
  7. 3057263Species Escherichia coli [TaxId:83333] [357325] (1 PDB entry)
  8. 3057295Domain d6e4ba1: 6e4b A:1-202 [357357]
    Other proteins in same PDB: d6e4ba2, d6e4bb2, d6e4bc2, d6e4bd2
    automated match to d4ij6b_
    complexed with 1pe, cl, gol

Details for d6e4ba1

PDB Entry: 6e4b (more details), 2.55 Å

PDB Description: the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655
PDB Compounds: (A:) Adenosylcobalamin/alpha-ribazole phosphatase

SCOPe Domain Sequences for d6e4ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e4ba1 c.60.1.0 (A:1-202) automated matches {Escherichia coli [TaxId: 83333]}
mrlwlirhgetqanidglysghaptpltargieqaqnlhtllhgvsfdlvlcseleraqh
tarlvlsdrqlpvqiipelnemffgdwemrhhrdlmqedaenysawcndwqhaiptngeg
fqafsqrverfiarlsefqhyqnilvvshqgvlslliarligmpaeamwhfrvdqgcwsa
idinqkfatlrvlnsraigven

SCOPe Domain Coordinates for d6e4ba1:

Click to download the PDB-style file with coordinates for d6e4ba1.
(The format of our PDB-style files is described here.)

Timeline for d6e4ba1:

  • d6e4ba1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13