Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (21 species) not a true protein |
Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries) |
Domain d6awwa_: 6aww A: [357353] automated match to d4m9ba_ complexed with bzj, na |
PDB Entry: 6aww (more details), 2.3 Å
SCOPe Domain Sequences for d6awwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6awwa_ d.129.3.0 (A:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]} gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht kgdakpdeeelkkgkakgeglfraiegyvlanptqy
Timeline for d6awwa_:
View in 3D Domains from other chains: (mouse over for more information) d6awwb_, d6awwc_, d6awwd_, d6awwe_ |