Lineage for d6e47g_ (6e47 G:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (619 PDB entries)
  8. 3057280Domain d6e47g_: 6e47 G: [357342]
    automated match to d5ffla_
    complexed with cho, edo, mg

Details for d6e47g_

PDB Entry: 6e47 (more details), 1.95 Å

PDB Description: crystal structure of the murine norovirus vp1 p domain in complex with the cd300lf receptor and glycochenodeoxycholic acid
PDB Compounds: (G:) CMRF35-like molecule 1

SCOPe Domain Sequences for d6e47g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e47g_ b.1.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpvtgpeevsgqeqgsltvqcrytsgwkdykkywcqgvpqrscktlvetdaseqlvkkn
rvsirdnqrdfiftvtmedlrmsdagiywcgitkggldpmfkvtvnigpvpt

SCOPe Domain Coordinates for d6e47g_:

Click to download the PDB-style file with coordinates for d6e47g_.
(The format of our PDB-style files is described here.)

Timeline for d6e47g_:

  • d6e47g_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13