Lineage for d6dj4a3 (6dj4 A:463-609)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (39 species)
    not a true protein
  7. 2370464Species Bacillus thuringiensis [TaxId:1428] [255814] (3 PDB entries)
  8. 3057271Domain d6dj4a3: 6dj4 A:463-609 [357333]
    Other proteins in same PDB: d6dj4a1, d6dj4a2
    automated match to d1ciya1

Details for d6dj4a3

PDB Entry: 6dj4 (more details), 3.01 Å

PDB Description: crystal structure of bacillus thuringiensis cry1a.105 tryptic core
PDB Compounds: (A:) Cry1A.105

SCOPe Domain Sequences for d6dj4a3:

Sequence, based on SEQRES records: (download)

>d6dj4a3 b.18.1.0 (A:463-609) automated matches {Bacillus thuringiensis [TaxId: 1428]}
nniiasdsitqiplvkahtlqsgttvvrgpgftggdilrrtsggpfaytivningqlpqr
yrariryasttnlriyvtvagerifagqfnktmdtgdpltfqsfsyatintaftfpmsqs
sftvgadtfssgnevyidrfelipvta

Sequence, based on observed residues (ATOM records): (download)

>d6dj4a3 b.18.1.0 (A:463-609) automated matches {Bacillus thuringiensis [TaxId: 1428]}
nniiasdsitqiplvkahtlqsgttvvrgpgftggdilrrtsggpfaytivninpqryra
riryasttnlriyvtvagerifagqfnktmdtgdpltfqsfsyatintaftfpmsqssft
vgadtfssgnevyidrfelipvta

SCOPe Domain Coordinates for d6dj4a3:

Click to download the PDB-style file with coordinates for d6dj4a3.
(The format of our PDB-style files is described here.)

Timeline for d6dj4a3:

  • d6dj4a3 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13