SCOPe 2.08: Domain d6ayrb1: 6ayr B:1-228

Lineage for d6ayrb1 (6ayr B:1-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (46 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [357249] (6 PDB entries)

8. Domain d6ayrb1: 6ayr B:1-228 [357321]
   Other proteins in same PDB: d6ayra2, d6ayrb2, d6ayrc2, d6ayrd2
   automated match to d4p54a_
   complexed with big, edo

Details for d6ayrb1

PDB Entry: 6ayr, 1.95 Å

PDB Description: crystal structure of campylobacter jejuni 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with butylthio- dadme-immucillin-a

PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d6ayrb1:

Sequence; same for both SEQRES and ATOM records:

>d6ayrb1 c.56.2.0 (B:1-228) automated matches {Campylobacter jejuni [TaxId: 197]}
mkiailgamseeitplletlkdytkiehanntyyfakykdhelvlayskigkvnstlsas
vmiekfgaqvllftgvagafnpeleigdllyatklaqydlditafghplgfvpgneifik
tdeklnnlalevakelniklragiiatgdeficdeakkakireifnadacemegasvalv
cdalkvpcfilramsdkagekaefdfdefvinsakisanfvlkmcekl

Timeline for d6ayrb1:

• d6ayrb1 first appeared in SCOPe 2.07