Lineage for d6atrb2 (6atr B:81-222)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2321907Protein Class alpha GST [81349] (8 species)
  7. 2321920Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (34 PDB entries)
    Uniprot P08263
  8. 3057255Domain d6atrb2: 6atr B:81-222 [357317]
    Other proteins in same PDB: d6atra1, d6atrb1
    automated match to d1k3ya1
    complexed with bws, edo, gsn

Details for d6atrb2

PDB Entry: 6atr (more details), 1.29 Å

PDB Description: crystal structure of hgsta1-1 complexed with two gsh analogues in each subunit
PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d6atrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6atrb2 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d6atrb2:

Click to download the PDB-style file with coordinates for d6atrb2.
(The format of our PDB-style files is described here.)

Timeline for d6atrb2:

  • d6atrb2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6atrb1