Lineage for d6axya1 (6axy A:1-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717976Domain d6axya1: 6axy A:1-147 [357312]
    Other proteins in same PDB: d6axya2
    automated match to d4xfxa1
    complexed with cl, iod; mutant

Details for d6axya1

PDB Entry: 6axy (more details), 2.78 Å

PDB Description: structure of the v11i/t58a/i124a mutant of the hiv-1 capsid protein
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6axya1:

Sequence, based on SEQRES records: (download)

>d6axya1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmihqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnavg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppapvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d6axya1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqmihqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnavgghqaa
mqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppap
vgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d6axya1:

Click to download the PDB-style file with coordinates for d6axya1.
(The format of our PDB-style files is described here.)

Timeline for d6axya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6axya2