Lineage for d6awyb_ (6awy B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539333Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2539334Protein automated matches [190218] (22 species)
    not a true protein
  7. 2539518Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries)
  8. 3057244Domain d6awyb_: 6awy B: [357306]
    automated match to d4m9ba_
    complexed with na, so4

Details for d6awyb_

PDB Entry: 6awy (more details), 2.1 Å

PDB Description: structure of peanut allergen ara h 8.01.
PDB Compounds: (B:) Ara h 8 allergen

SCOPe Domain Sequences for d6awyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6awyb_ d.129.3.0 (B:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

SCOPe Domain Coordinates for d6awyb_:

Click to download the PDB-style file with coordinates for d6awyb_.
(The format of our PDB-style files is described here.)

Timeline for d6awyb_:

  • d6awyb_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13