Lineage for d6dpsf_ (6dps F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361818Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2361836Family b.1.17.0: automated matches [254248] (1 protein)
    not a true family
  6. 2361837Protein automated matches [254567] (2 species)
    not a true protein
  7. 3057238Species Neisseria meningitidis [TaxId:662598] [357300] (1 PDB entry)
  8. 3057239Domain d6dpsf_: 6dps F: [357301]
    automated match to d1vrsc_
    complexed with zn

Details for d6dpsf_

PDB Entry: 6dps (more details), 2.56 Å

PDB Description: crystal structure of neisseria meningitidis dsbd n-terminal domain in the oxidised form
PDB Compounds: (F:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d6dpsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dpsf_ b.1.17.0 (F:) automated matches {Neisseria meningitidis [TaxId: 662598]}
dllppekafvpelavaddgvnvrfriadgyymyqakivgktdpadllgqpsfskgeeked
effgrqtvyhheaqvafpyakavgepyklvltyqgcaevgvcyppvdtefdisgngtyhp

SCOPe Domain Coordinates for d6dpsf_:

Click to download the PDB-style file with coordinates for d6dpsf_.
(The format of our PDB-style files is described here.)

Timeline for d6dpsf_:

  • d6dpsf_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13