Lineage for d6awxa_ (6awx A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539333Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2539334Protein automated matches [190218] (22 species)
    not a true protein
  7. 2539518Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries)
  8. 3057219Domain d6awxa_: 6awx A: [357281]
    automated match to d4m9ba_
    complexed with na

Details for d6awxa_

PDB Entry: 6awx (more details), 2.7 Å

PDB Description: structure of pr-10 allergen ara h 8.01.
PDB Compounds: (A:) Ara h 8 allergen

SCOPe Domain Sequences for d6awxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6awxa_ d.129.3.0 (A:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

SCOPe Domain Coordinates for d6awxa_:

Click to download the PDB-style file with coordinates for d6awxa_.
(The format of our PDB-style files is described here.)

Timeline for d6awxa_:

  • d6awxa_ appears in periodic updates to SCOPe 2.07 starting on 2018-09-13