Lineage for d6athb2 (6ath B:310-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2326512Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2326525Protein Cyclin A [47956] (2 species)
  7. 2326526Species Cow (Bos taurus) [TaxId:9913] [47958] (10 PDB entries)
  8. 3057212Domain d6athb2: 6ath B:310-432 [357274]
    Other proteins in same PDB: d6atha_
    automated match to d3ddqb2
    complexed with so4

Details for d6athb2

PDB Entry: 6ath (more details), 1.82 Å

PDB Description: cdk2/cyclin a/p27-kid-deltac
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d6athb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6athb2 a.74.1.1 (B:310-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d6athb2:

Click to download the PDB-style file with coordinates for d6athb2.
(The format of our PDB-style files is described here.)

Timeline for d6athb2:

  • d6athb2 appears in periodic updates to SCOPe 2.07 starting on 2018-09-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6athb1
View in 3D
Domains from other chains:
(mouse over for more information)
d6atha_