SCOPe 2.08: Domain d6axva2: 6axv A:148-221

Lineage for d6axva2 (6axv A:148-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d6axva2: 6axv A:148-221 [357261]
   Other proteins in same PDB: d6axva1
   automated match to d2m8pa2
   complexed with 1b0, cl, iod; mutant

Details for d6axva2

PDB Entry: 6axv, 2.77 Å

PDB Description: structure of the t58s/t107i/p122a mutant of the hiv-1 capsid protein in complex with pf-3450074 (pf74)

PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6axva2:

Sequence; same for both SEQRES and ATOM records:

>d6axva2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

Timeline for d6axva2:

• d6axva2 first appeared in SCOPe 2.07