Lineage for d6axva1 (6axv A:1-147)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326304Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2326305Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2326306Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2326345Protein HIV-1 capsid protein [47945] (1 species)
  7. 2326346Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (62 PDB entries)
  8. 3057198Domain d6axva1: 6axv A:1-147 [357260]
    Other proteins in same PDB: d6axva2
    automated match to d4xfxa1
    complexed with 1b0, cl, iod; mutant

Details for d6axva1

PDB Entry: 6axv (more details), 2.77 Å

PDB Description: structure of the t58s/t107i/p122a mutant of the hiv-1 capsid protein in complex with pf-3450074 (pf74)
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d6axva1:

Sequence, based on SEQRES records: (download)

>d6axva1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnsvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagitstlqeqigwmth
napipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records): (download)

>d6axva1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlnsvgghqaam
qmlketineeaaewdrlhpvhagpiapgqmreprgsdiagitstlqeqigwmthnapipv
geiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d6axva1:

Click to download the PDB-style file with coordinates for d6axva1.
(The format of our PDB-style files is described here.)

Timeline for d6axva1:

  • d6axva1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-12

View in 3D
Domains from same chain:
(mouse over for more information)
d6axva2