Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.14: Fumble-like [159623] (6 proteins) Pfam PF03630; type II pantothenate kinase-like |
Protein automated matches [259360] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [357241] (6 PDB entries) |
Domain d6avpc_: 6avp C: [357243] automated match to d4nb4a_ complexed with adp, mg, n7e |
PDB Entry: 6avp (more details), 2.3 Å
SCOPe Domain Sequences for d6avpc_:
Sequence, based on SEQRES records: (download)
>d6avpc_ c.55.1.14 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]} vgidaggtlikivqeqdnqrtfkteltknidqvvewlnqqqieklcltggnagviaenin ipaqifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtggg miqglgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhh ldadftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytv lrgckpyyvengafsgaigalyl
>d6avpc_ c.55.1.14 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]} vgidaggtlikivqertfkteltknidqvvewlnqqqieklcltggnagviaeninipaq ifvefdaasqglgillkeqghdladyifanvgtgtslhyfdgqsqrrvggigtgggmiqg lgyllsqitdykqltdmaqhgdrntidlkvrhiykdteppipgdltaanfghvlhhldad ftpsnklaavigvvgevvttmaitvarefktenivyigssfhnnallrkvvedytvlrgc kpyyvengafsgaigalyl
Timeline for d6avpc_: