Lineage for d5z85r_ (5z85 R:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727251Domain d5z85r_: 5z85 R: [357236]
    Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85c_, d5z85d_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85n_, d5z85o1, d5z85o2, d5z85p_, d5z85q_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_
    automated match to d1v54e_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z85r_

PDB Entry: 5z85 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the another batch crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (R:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5z85r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z85r_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5z85r_:

Click to download the PDB-style file with coordinates for d5z85r_.
(The format of our PDB-style files is described here.)

Timeline for d5z85r_: